PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0569s0030.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SRS
Protein Properties Length: 333aa    MW: 36028.9 Da    PI: 7.4171
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0569s0030.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022191e-671182624154
                  DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstk 90 
                              ++sCqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpa+krrerqqql  ++++++ + + +++kr+re+    +s+l++t+
  SapurV1A.0569s0030.1.p 118 SSISCQDCGNQAKKDCIHMRCRTCCKSRGFDCQTHVKSTWVPASKRRERQQQLDLLQQQQQLQIRGENPKRQREN---PNSSLACTR 201
                             6789*******************************************************9999999999999985...999****** PP

                  DUF702  91 lssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                             l+++ s   le  ++P+evss+a+frcvr+s++d++ e laYqtav+igGhvfkGiLyd+G+++
  SapurV1A.0569s0030.1.p 202 LANNMS--GLELGNFPSEVSSPALFRCVRMSGIDES-EMLAYQTAVNIGGHVFKGILYDHGPDS 262
                             988765..688999*******************986.579**********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051426.4E-64119261IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.8E-28121163IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016249.6E-24214260IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MAGLFSLGRG GSSSNNQEDQ QNNNNPPTEI PQESWFWYKS EDIPYKSFEL WQQQQQQHQQ  60
LLHQRHQNPQ QDLYSSAAGL GVGPSRTSIN ISDESSSRSA AEAFMMIRPG GSGTGGASSI  120
SCQDCGNQAK KDCIHMRCRT CCKSRGFDCQ THVKSTWVPA SKRRERQQQL DLLQQQQQLQ  180
IRGENPKRQR ENPNSSLACT RLANNMSGLE LGNFPSEVSS PALFRCVRMS GIDESEMLAY  240
QTAVNIGGHV FKGILYDHGP DSNYMAPGET SSGGGGAQPL NLIIITAGTA TGGGGGVTVA  300
STTAAFLDPS SLYPAPLNTF MAGTQFFPNP RS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006380784.11e-166hypothetical protein POPTR_0007s13610g
SwissprotQ9SD401e-106SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLU5G8I91e-166U5G8I9_POPTR; Uncharacterized protein
STRINGPOPTR_0007s13610.11e-166(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.15e-77Lateral root primordium (LRP) protein-related